CAS 1165910-22-4 Manufacturer: Reliable Supplier for High-quality Chemicals

Hebei Zhanshun Technology Co., Ltd. is a China-based manufacturer, supplier, and factory that specializes in the production of CAS 1165910-22-4. This product, also known as tert-Butyl (2S)-2-(4-chlorophenyl)-4,4-difluoropentanoate, is a chemical compound that finds its use in various applications, including pharmaceutical and agrochemical industries. It is a vital intermediate for the synthesis of different drugs and pharmaceuticals.

As a reliable manufacturer and supplier of CAS 1165910-22-4, Hebei Zhanshun Technology Co., Ltd. ensures that the product meets all the specific requirements of customers. The company uses advanced manufacturing techniques and equipment to produce high-quality CAS 1165910-22-4 that meets international standards. Additionally, the company has a team of experts who provide technical support and consultation to clients on the appropriate use and handling of the product.

In conclusion, Hebei Zhanshun Technology Co., Ltd. is a reputable manufacturer and supplier of CAS 1165910-22-4. The company's commitment to delivering high-quality products, coupled with its technical expertise, makes it an ideal partner for clients seeking reliable and trustworthy suppliers of CAS 1165910-22-4.

Featured Products

  • CAS 1165910-22-4 is a powerful compound used in various industries for its exceptional properties. The substance, also known as Vilanterol, belongs to the group of long-acting beta-agonists (LABAs) and is primarily utilized in asthma and chronic obstructive pulmonary disease (COPD) treatments. Vilanterol works by activating beta-2 adrenergic receptors in the lungs, which helps to relax the muscles surrounding the airways, making it easier to breathe. It also enhances the production of cAMP, a cyclic nucleotide that plays a crucial role in regulating various biological processes in the body. Apart from its medicinal uses, Vilanterol has also found applications in the field of agriculture, particularly for enhancing plant growth. It acts as a plant growth regulator, stimulating the growth of roots, leaves, and flowers, and promoting crop yields. The compound is synthesized using advanced methods to ensure its purity and efficacy. It is available in different forms, including powders, tablets, and inhalers, making it easy to administer for patients of all ages. In conclusion, CAS 1165910-22-4 is a versatile compound that has numerous applications in various industries. Its efficacy, combined with its ease of use, makes it a popular choice for treating respiratory diseases and promoting plant growth. If you are in search of a reliable source to purchase Vilanterol or its derivatives, do not hesitate to contact us for high-quality products.

  • Affordable Prescription Glasses and Sunglasses Online Starting from $55

    Not Found APIKEY

  • Broad Spectrum Fungicide Suppliers: Discover Iprodione - A Synthetic Solution for Crops and Turf

    Hebei Zhanshun Technology Co., Ltd. is a leading supplier and exporter of chemical raw materials that has been in operation for many years. The company has established itself as a trusted name in the

  • Top 10 Recommended Clean Collagen Powders for 2021: A Guide to Finding Your Ideal Product

    Hebei Zhanshun Technology Co., Ltd. is a well-established provider of applied chemical raw materials that has been in operation since 2014. With a registered capital of 10 million yuan, the company ha

  • Hormone Powder for Muscle Wasting: A Quality Prohormone SARMS Product

    article: Hebei Zhanshun Technology Co., Ltd. has recently announced the launch of their latest product, the MK-2866 Prohormone SARMS Ostarine Gtx-024 Hormone powder for muscle wasting. This product i
    • ;
Growth Hormone from chicken, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, Haru Insecticide, HCG, Anestacon, Lidocaine Powder Anaesthin, Medicine grade steroid, Blue Copper Peptide, CAS 52315-92-1, Melatonin Bnf,